PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_06026.1_g00001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family bZIP
Protein Properties Length: 120aa    MW: 14058.7 Da    PI: 9.2604
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_06026.1_g00001.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_138.62.3e-124194356
                             XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                   bZIP_1  3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkev 56
                             + k++rrk +NRe+ArrsR RK+  + eL      L +eN+ L++el++ ++  
  Rsa1.0_06026.1_g00001.1 41 DEKKQRRKVSNRESARRSRMRKRRHLNELWSMLVHLINENRCLIDELSRANEGN 94
                             569********************************************9988765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1702.7E-934115No hitNo description
SMARTSM003381.5E-1139103IPR004827Basic-leucine zipper domain
PfamPF077162.2E-94089IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.341104IPR004827Basic-leucine zipper domain
SuperFamilySSF579592.25E-104392No hitNo description
PROSITE patternPS0003604661IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0042803Molecular Functionprotein homodimerization activity
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 120 aa     Download sequence    Send to blast
MDGFVYNLPG ANPNQQFFNN QVPLVNLSAT SDESNRSADD DEKKQRRKVS NRESARRSRM  60
RKRRHLNELW SMLVHLINEN RCLIDELSRA NEGNENVVEE NKKLREENSN LRKMIGEIGF
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
14563RRKVSNRESARRSRMRKRR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013619983.11e-70PREDICTED: basic leucine zipper 43
SwissprotQ9CA462e-53BZIP8_ARATH; Basic leucine zipper 8
TrEMBLA0A0D3AP401e-70A0A0D3AP40_BRAOL; Uncharacterized protein
STRINGBra038341.1-P3e-69(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM150351619
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G68880.12e-22basic leucine-zipper 8